| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
| Domain d2gf2d2: 2gf2 D:202-333 [230747] Other proteins in same PDB: d2gf2a1, d2gf2a3, d2gf2b1, d2gf2b3, d2gf2c1, d2gf2d1 automated match to d2gf2b2 |
PDB Entry: 2gf2 (more details), 2.38 Å
SCOPe Domain Sequences for d2gf2d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf2d2 a.100.1.0 (D:202-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdtynpvp
gvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakgyskk
dfssvfqflree
Timeline for d2gf2d2: