Lineage for d2gf2a1 (2gf2 A:41-201)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847125Domain d2gf2a1: 2gf2 A:41-201 [230744]
    Other proteins in same PDB: d2gf2a2, d2gf2a3, d2gf2b2, d2gf2b3, d2gf2c2, d2gf2d2
    automated match to d2gf2b1

Details for d2gf2a1

PDB Entry: 2gf2 (more details), 2.38 Å

PDB Description: Crystal structure of human hydroxyisobutyrate dehydrogenase
PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2gf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf2a1 c.2.1.0 (A:41-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadrii
tmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapvs
ggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycga

SCOPe Domain Coordinates for d2gf2a1:

Click to download the PDB-style file with coordinates for d2gf2a1.
(The format of our PDB-style files is described here.)

Timeline for d2gf2a1: