Lineage for d1as8a1 (1as8 A:4-166)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 292711Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 292712Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 293018Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)
  6. 293096Protein Nitrite reductase, NIR [49551] (4 species)
    consists of two domains of this fold
  7. 293120Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (21 PDB entries)
  8. 293179Domain d1as8a1: 1as8 A:4-166 [23074]

Details for d1as8a1

PDB Entry: 1as8 (more details), 1.85 Å

PDB Description: structure of nitrite bound to reduced alcaligenes faecalis nitrite reductase at cryo temperature

SCOP Domain Sequences for d1as8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1as8a1 b.6.1.3 (A:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

SCOP Domain Coordinates for d1as8a1:

Click to download the PDB-style file with coordinates for d1as8a1.
(The format of our PDB-style files is described here.)

Timeline for d1as8a1: