| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) ![]() core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
| Family a.238.1.0: automated matches [191660] (1 protein) not a true family |
| Protein automated matches [191240] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189695] (7 PDB entries) |
| Domain d2ficb_: 2fic B: [230735] automated match to d4avma_ complexed with xe |
PDB Entry: 2fic (more details), 1.99 Å
SCOPe Domain Sequences for d2ficb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ficb_ a.238.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kdeqfeqcvqnfnkqltegtrlqkdlrtylasvkamheaskklneclqevyepdwpgrde
ankiaenndllwmdyhqklvdqalltmdtylgqfpdiksriakrgrklvdydsarhhyes
lqtakkkdeakiakaeeelikaqkvfeemnvdlqeelpslwnsrvgfyvntfqsiaglee
nfhkemsklnqnlndvlvgle
Timeline for d2ficb_: