Lineage for d2ficb_ (2fic B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020027Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2020028Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2020087Family a.238.1.0: automated matches [191660] (1 protein)
    not a true family
  6. 2020088Protein automated matches [191240] (2 species)
    not a true protein
  7. 2020089Species Human (Homo sapiens) [TaxId:9606] [189695] (7 PDB entries)
  8. 2020094Domain d2ficb_: 2fic B: [230735]
    automated match to d4avma_
    complexed with xe

Details for d2ficb_

PDB Entry: 2fic (more details), 1.99 Å

PDB Description: the crystal structure of the bar domain from human bin1/amphiphysin ii and its implications for molecular recognition
PDB Compounds: (B:) bridging integrator 1

SCOPe Domain Sequences for d2ficb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ficb_ a.238.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kdeqfeqcvqnfnkqltegtrlqkdlrtylasvkamheaskklneclqevyepdwpgrde
ankiaenndllwmdyhqklvdqalltmdtylgqfpdiksriakrgrklvdydsarhhyes
lqtakkkdeakiakaeeelikaqkvfeemnvdlqeelpslwnsrvgfyvntfqsiaglee
nfhkemsklnqnlndvlvgle

SCOPe Domain Coordinates for d2ficb_:

Click to download the PDB-style file with coordinates for d2ficb_.
(The format of our PDB-style files is described here.)

Timeline for d2ficb_: