SCOPe 2.08: Domain d2ficb_: 2fic B:

Lineage for d2ficb_ (2fic B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.0: automated matches [191660] (1 protein)
   not a true family

6. Protein automated matches [191240] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189695] (6 PDB entries)

8. Domain d2ficb_: 2fic B: [230735]
   automated match to d4avma_
   complexed with xe

Details for d2ficb_

PDB Entry: 2fic, 1.99 Å

PDB Description: the crystal structure of the bar domain from human bin1/amphiphysin ii and its implications for molecular recognition

PDB Compounds: (B:) Myc box-dependent-interacting protein 1

SCOPe Domain Sequences for d2ficb_:

Sequence; same for both SEQRES and ATOM records:

>d2ficb_ a.238.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kdeqfeqcvqnfnkqltegtrlqkdlrtylasvkamheaskklneclqevyepdwpgrde
ankiaenndllwmdyhqklvdqalltmdtylgqfpdiksriakrgrklvdydsarhhyes
lqtakkkdeakiakaeeelikaqkvfeemnvdlqeelpslwnsrvgfyvntfqsiaglee
nfhkemsklnqnlndvlvgle

Timeline for d2ficb_:

• d2ficb_ first appeared in SCOPe 2.03
  
• d2ficb_ appears in SCOPe 2.07