Lineage for d2fica_ (2fic A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509167Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1509168Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 1509225Family a.238.1.0: automated matches [191660] (1 protein)
    not a true family
  6. 1509226Protein automated matches [191240] (2 species)
    not a true protein
  7. 1509227Species Human (Homo sapiens) [TaxId:9606] [189695] (5 PDB entries)
  8. 1509230Domain d2fica_: 2fic A: [230734]
    automated match to d4avma_
    complexed with xe

Details for d2fica_

PDB Entry: 2fic (more details), 1.99 Å

PDB Description: the crystal structure of the bar domain from human bin1/amphiphysin ii and its implications for molecular recognition
PDB Compounds: (A:) bridging integrator 1

SCOPe Domain Sequences for d2fica_:

Sequence, based on SEQRES records: (download)

>d2fica_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqfeqcvqnfnkqltegtrlqkdlrtylasvkamheaskklneclqevyepdwpgrdean
kiaenndllwmdyhqklvdqalltmdtylgqfpdiksriakrgrklvdydsarhhyeslq
takkkdeakiakaeeelikaqkvfeemnvdlqeelpslwnsrvgfyvntfqsiagleenf
hkemsklnqnlndvlvgl

Sequence, based on observed residues (ATOM records): (download)

>d2fica_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqfeqcvqnfnkqltegtrlqkdlrtylasvkamheaskklneclqevyepdwpgrdean
kiaenndllwmdyhqklvdqalltmdtylgqfpdiksriakrgrklvdydsarhhyeslq
tkiakaeeelikaqkvfeemnvdlqeelpslwnsrvgfyvntfqsiagleenfhkemskl
nqnlndvlvgl

SCOPe Domain Coordinates for d2fica_:

Click to download the PDB-style file with coordinates for d2fica_.
(The format of our PDB-style files is described here.)

Timeline for d2fica_: