![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) ![]() core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
![]() | Family a.238.1.0: automated matches [191660] (1 protein) not a true family |
![]() | Protein automated matches [191240] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189695] (5 PDB entries) |
![]() | Domain d2fica_: 2fic A: [230734] automated match to d4avma_ complexed with xe |
PDB Entry: 2fic (more details), 1.99 Å
SCOPe Domain Sequences for d2fica_:
Sequence, based on SEQRES records: (download)
>d2fica_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eqfeqcvqnfnkqltegtrlqkdlrtylasvkamheaskklneclqevyepdwpgrdean kiaenndllwmdyhqklvdqalltmdtylgqfpdiksriakrgrklvdydsarhhyeslq takkkdeakiakaeeelikaqkvfeemnvdlqeelpslwnsrvgfyvntfqsiagleenf hkemsklnqnlndvlvgl
>d2fica_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eqfeqcvqnfnkqltegtrlqkdlrtylasvkamheaskklneclqevyepdwpgrdean kiaenndllwmdyhqklvdqalltmdtylgqfpdiksriakrgrklvdydsarhhyeslq tkiakaeeelikaqkvfeemnvdlqeelpslwnsrvgfyvntfqsiagleenfhkemskl nqnlndvlvgl
Timeline for d2fica_: