Lineage for d2fa5b_ (2fa5 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695211Species Xanthomonas campestris [TaxId:339] [230729] (1 PDB entry)
  8. 2695213Domain d2fa5b_: 2fa5 B: [230731]
    automated match to d3cjna_
    complexed with cl

Details for d2fa5b_

PDB Entry: 2fa5 (more details), 1.8 Å

PDB Description: The crystal structure of an unliganded multiple antibiotic-resistance repressor (MarR) from Xanthomonas campestris
PDB Compounds: (B:) transcriptional regulator marR/emrR family

SCOPe Domain Sequences for d2fa5b_:

Sequence, based on SEQRES records: (download)

>d2fa5b_ a.4.5.0 (B:) automated matches {Xanthomonas campestris [TaxId: 339]}
sphpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasev
sdrtamdkvavsravarllergfirrethgddrrrsmlalspagrqvyetvaplvnemeq
rlmsvfsaeeqqtlerlidrlakdglprma

Sequence, based on observed residues (ATOM records): (download)

>d2fa5b_ a.4.5.0 (B:) automated matches {Xanthomonas campestris [TaxId: 339]}
sphpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasev
sdrtamdkvavsravarllergfirresmlalspagrqvyetvaplvnemeqrlmsvfsa
eeqqtlerlidrlakdglprma

SCOPe Domain Coordinates for d2fa5b_:

Click to download the PDB-style file with coordinates for d2fa5b_.
(The format of our PDB-style files is described here.)

Timeline for d2fa5b_: