![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Xanthomonas campestris [TaxId:339] [230729] (1 PDB entry) |
![]() | Domain d2fa5b_: 2fa5 B: [230731] automated match to d3cjna_ complexed with cl |
PDB Entry: 2fa5 (more details), 1.8 Å
SCOPe Domain Sequences for d2fa5b_:
Sequence, based on SEQRES records: (download)
>d2fa5b_ a.4.5.0 (B:) automated matches {Xanthomonas campestris [TaxId: 339]} sphpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasev sdrtamdkvavsravarllergfirrethgddrrrsmlalspagrqvyetvaplvnemeq rlmsvfsaeeqqtlerlidrlakdglprma
>d2fa5b_ a.4.5.0 (B:) automated matches {Xanthomonas campestris [TaxId: 339]} sphpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasev sdrtamdkvavsravarllergfirresmlalspagrqvyetvaplvnemeqrlmsvfsa eeqqtlerlidrlakdglprma
Timeline for d2fa5b_: