SCOPe 2.05: Domain d2fa5a_: 2fa5 A:

Lineage for d2fa5a_ (2fa5 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Xanthomonas campestris [TaxId:339] [230729] (1 PDB entry)

8. Domain d2fa5a_: 2fa5 A: [230730]
   automated match to d3cjna_
   complexed with cl

Details for d2fa5a_

PDB Entry: 2fa5, 1.8 Å

PDB Description: The crystal structure of an unliganded multiple antibiotic-resistance repressor (MarR) from Xanthomonas campestris

PDB Compounds: (A:) transcriptional regulator marR/emrR family

SCOPe Domain Sequences for d2fa5a_:

Sequence, based on SEQRES records:

>d2fa5a_ a.4.5.0 (A:) automated matches {Xanthomonas campestris [TaxId: 339]}
hpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasevsd
rtamdkvavsravarllergfirrethgddrrrsmlalspagrqvyetvaplvnemeqrl
msvfsaeeqqtlerlidrlakdglprma

Sequence, based on observed residues (ATOM records):

>d2fa5a_ a.4.5.0 (A:) automated matches {Xanthomonas campestris [TaxId: 339]}
hpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasevsd
rtamdkvavsravarllergfirrsmlalspagrqvyetvaplvnemeqrlmsvfsaeeq
qtlerlidrlakdglprma

Timeline for d2fa5a_:

• d2fa5a_ first appeared in SCOPe 2.03
  
• d2fa5a_ appears in SCOPe 2.04
  
• d2fa5a_ appears in SCOPe 2.06
  
• d2fa5a_ appears in the current release, SCOPe 2.08