Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Xanthomonas campestris [TaxId:339] [230729] (1 PDB entry) |
Domain d2fa5a_: 2fa5 A: [230730] automated match to d3cjna_ complexed with cl |
PDB Entry: 2fa5 (more details), 1.8 Å
SCOPe Domain Sequences for d2fa5a_:
Sequence, based on SEQRES records: (download)
>d2fa5a_ a.4.5.0 (A:) automated matches {Xanthomonas campestris [TaxId: 339]} hpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasevsd rtamdkvavsravarllergfirrethgddrrrsmlalspagrqvyetvaplvnemeqrl msvfsaeeqqtlerlidrlakdglprma
>d2fa5a_ a.4.5.0 (A:) automated matches {Xanthomonas campestris [TaxId: 339]} hpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasevsd rtamdkvavsravarllergfirrsmlalspagrqvyetvaplvnemeqrlmsvfsaeeq qtlerlidrlakdglprma
Timeline for d2fa5a_: