SCOPe 2.06: Domain d2ewgb_: 2ewg B:

Lineage for d2ewgb_ (2ewg B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (37 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [230726] (15 PDB entries)

8. Domain d2ewgb_: 2ewg B: [230728]
   automated match to d3id0a_
   complexed with m0n, mg, pgo

Details for d2ewgb_

PDB Entry: 2ewg, 2.48 Å

PDB Description: t. brucei farnesyl diphosphate synthase complexed with minodronate

PDB Compounds: (B:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d2ewgb_:

Sequence; same for both SEQRES and ATOM records:

>d2ewgb_ a.128.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
ktykrqk

Timeline for d2ewgb_:

• d2ewgb_ first appeared in SCOPe 2.03
  
• d2ewgb_ appears in SCOPe 2.05
  
• d2ewgb_ appears in SCOPe 2.07
  
• d2ewgb_ appears in the current release, SCOPe 2.08