SCOPe 2.05: Domain d2e7xa2: 2e7x A:61-150

Lineage for d2e7xa2 (2e7x A:61-150)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (21 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:111955] [230708] (2 PDB entries)

8. Domain d2e7xa2: 2e7x A:61-150 [230716]
   Other proteins in same PDB: d2e7xa1
   automated match to d2cyya2
   complexed with gln, mg

Details for d2e7xa2

PDB Entry: 2e7x, 1.8 Å

PDB Description: structure of the lrp/asnc like transcriptional regulator from sulfolobus tokodaii 7 complexed with its cognate ligand

PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2e7xa2:

Sequence; same for both SEQRES and ATOM records:

>d2e7xa2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
ervmsipevertstqvvvkiikespnivif

Timeline for d2e7xa2:

• d2e7xa2 first appeared in SCOPe 2.03
  
• d2e7xa2 appears in SCOPe 2.04
  
• d2e7xa2 appears in SCOPe 2.06
  
• d2e7xa2 appears in the current release, SCOPe 2.08