Lineage for d2efoa2 (2efo A:61-150)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907207Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1907208Protein automated matches [190081] (21 species)
    not a true protein
  7. 1907431Species Sulfolobus tokodaii [TaxId:273063] [230709] (7 PDB entries)
  8. 1907437Domain d2efoa2: 2efo A:61-150 [230713]
    Other proteins in same PDB: d2efoa1
    automated match to d2cyya2
    complexed with mg

Details for d2efoa2

PDB Entry: 2efo (more details), 2.4 Å

PDB Description: crystal structure of tyr77 to ala of st1022 from sulfolobus tokodaii 7
PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2efoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efoa2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ldyivitsvkakygknahvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
ervmsipevertstqvvvkiikespnivif

SCOPe Domain Coordinates for d2efoa2:

Click to download the PDB-style file with coordinates for d2efoa2.
(The format of our PDB-style files is described here.)

Timeline for d2efoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2efoa1