Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (21 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:111955] [230708] (2 PDB entries) |
Domain d2efpa2: 2efp A:61-150 [230712] Other proteins in same PDB: d2efpa1 automated match to d2cyya2 complexed with gln, mg |
PDB Entry: 2efp (more details), 2.2 Å
SCOPe Domain Sequences for d2efpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efpa2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 111955]} ldyivitsvkakygknahvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl ervmsipevertstqvvvkiikespnivif
Timeline for d2efpa2: