Lineage for d2efpa2 (2efp A:61-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950541Species Sulfolobus tokodaii [TaxId:111955] [230708] (2 PDB entries)
  8. 2950543Domain d2efpa2: 2efp A:61-150 [230712]
    Other proteins in same PDB: d2efpa1
    automated match to d2cyya2
    complexed with gln, mg

Details for d2efpa2

PDB Entry: 2efp (more details), 2.2 Å

PDB Description: crystal structure of tyr77 to ala of st1022-glutamine complex from sulolobus tokodaii 7
PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2efpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efpa2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
ldyivitsvkakygknahvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
ervmsipevertstqvvvkiikespnivif

SCOPe Domain Coordinates for d2efpa2:

Click to download the PDB-style file with coordinates for d2efpa2.
(The format of our PDB-style files is described here.)

Timeline for d2efpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2efpa1