Lineage for d2eh6a_ (2eh6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132270Species Aquifex aeolicus [TaxId:224324] [230705] (1 PDB entry)
  8. 2132271Domain d2eh6a_: 2eh6 A: [230706]
    automated match to d3nx3a_
    complexed with plp

Details for d2eh6a_

PDB Entry: 2eh6 (more details), 1.9 Å

PDB Description: Crystal structure of acetylornithine aminotransferase from Aquifex aeolicus VF5
PDB Compounds: (A:) Acetylornithine aminotransferase

SCOPe Domain Sequences for d2eh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eh6a_ c.67.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
tylmnnyarlpvkfvrgkgvylydeegkeyldfvsgigvnslghaypkltealkeqvekl
lhvsnlyenpwqeelahklvkhfwtegkvffansgtesveaaiklarkywrdkgknkwkf
isfensfhgrtygslsatgqpkfhkgfeplvpgfsyaklndidsvyklldeetagiiiev
iqgeggvneasedflsklqeickekdvlliidevqtgigrtgefyayqhfnlkpdviala
kglgggvpigailareevaqsftpgshgstfggnplacragtvvvdevekllphvrevgn
yfkeklkelgkgkvkgrglmlglelereckdyvlkalekgllinctagkvlrflppliiq
kehidraisvlreil

SCOPe Domain Coordinates for d2eh6a_:

Click to download the PDB-style file with coordinates for d2eh6a_.
(The format of our PDB-style files is described here.)

Timeline for d2eh6a_: