Lineage for d2egzc_ (2egz C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1343361Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1343362Protein automated matches [190115] (51 species)
    not a true protein
  7. 1343398Species Aquifex aeolicus [TaxId:63363] [187668] (2 PDB entries)
  8. 1343400Domain d2egzc_: 2egz C: [230704]
    automated match to d3l9cb_
    complexed with tla

Details for d2egzc_

PDB Entry: 2egz (more details), 1.75 Å

PDB Description: Crystal structure of the 3-dehydroquinate dehydratase from Aquifex aeolicus VF5
PDB Compounds: (C:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2egzc_:

Sequence, based on SEQRES records: (download)

>d2egzc_ c.1.10.0 (C:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mliavplddtnfsenlkkakekgadivelrvdqfsdtslnyvkekleevhsqglktilti
rspeeggrevknreelfeelsplsdytdielssrgllvklynitkeagkkliisyhnfel
tppnwiirevlregyryggipkiavkansyedvarllcisrqvegekilismgdygkisr
lagyvfgsvitycslekafapgqipleemvelrkkfyrl

Sequence, based on observed residues (ATOM records): (download)

>d2egzc_ c.1.10.0 (C:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mliavplddtnfsenlkkakekgadivelrvdqfsdtslnyvkekleevhsqglktilti
rspeeggrevknreelfeelsplsdytdielssrgllvklynitkeagkkliisyhnfel
tppnwiirevlregyryggipkiavkansyedvarllcisrqvegekilismgdygkisr
lagyvfgsvitycslkafapgqipleemvelrkkfyrl

SCOPe Domain Coordinates for d2egzc_:

Click to download the PDB-style file with coordinates for d2egzc_.
(The format of our PDB-style files is described here.)

Timeline for d2egzc_: