![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Sulfolobus tokodaii [TaxId:111955] [230692] (3 PDB entries) |
![]() | Domain d2efpa1: 2efp A:1-60 [230701] Other proteins in same PDB: d2efpa2 automated match to d2cyya1 complexed with gln, mg |
PDB Entry: 2efp (more details), 2.2 Å
SCOPe Domain Sequences for d2efpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efpa1 a.4.5.0 (A:1-60) automated matches {Sulfolobus tokodaii [TaxId: 111955]} mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
Timeline for d2efpa1: