Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (41 species) not a true protein |
Domain d2e7wa1: 2e7w A:1-60 [230693] automated match to d2cyya1 |
PDB Entry: 2e7w (more details), 1.82 Å
SCOPe Domain Sequences for d2e7wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e7wa1 a.4.5.0 (A:1-60) automated matches {Sulfolobus tokodaii [TaxId: 111955]} mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
Timeline for d2e7wa1: