Lineage for d2e7wa1 (2e7w A:1-60)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695135Species Sulfolobus tokodaii [TaxId:111955] [230692] (3 PDB entries)
  8. 2695137Domain d2e7wa1: 2e7w A:1-60 [230693]
    Other proteins in same PDB: d2e7wa2
    automated match to d2cyya1
    complexed with gln, mg

Details for d2e7wa1

PDB Entry: 2e7w (more details), 1.82 Å

PDB Description: crystal structure of the lrp/asnc like transcriptional regulators from sulfolobus tokodaii 7
PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2e7wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7wa1 a.4.5.0 (A:1-60) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln

SCOPe Domain Coordinates for d2e7wa1:

Click to download the PDB-style file with coordinates for d2e7wa1.
(The format of our PDB-style files is described here.)

Timeline for d2e7wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e7wa2