Lineage for d2e54a_ (2e54 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898129Species Thermotoga maritima [TaxId:243274] [230690] (4 PDB entries)
  8. 2898130Domain d2e54a_: 2e54 A: [230691]
    automated match to d3nx3a_
    complexed with edo, na, plp

Details for d2e54a_

PDB Entry: 2e54 (more details), 1.5 Å

PDB Description: Crystal structure of acetylornithine aminotransferase from Thermotoga maritima
PDB Compounds: (A:) Acetylornithine aminotransferase

SCOPe Domain Sequences for d2e54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e54a_ c.67.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshprlveaikdqaekl
ihcsnlfwnrpqmelaellskntfggkvffantgteaneaaikiarkygkkksekkyril
sahnsfhgrtlgsltatgqpkyqkpfeplvpgfeyfefnnvedlrrkmsedvcavflepi
qgesgivpatkefleearklcdeydallvfdevqcgmgrtgklfayqkygvvpdvlttak
glgggvpigavivneranvlepgdhgttfggnplacragvtvikeltkegfleeveekgn
ylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfenkllvvpagnntirf
lppltveygeidlavetlkkvlqgi

SCOPe Domain Coordinates for d2e54a_:

Click to download the PDB-style file with coordinates for d2e54a_.
(The format of our PDB-style files is described here.)

Timeline for d2e54a_: