Lineage for d2e0aa1 (2e0a A:20-187)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1995156Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1995202Family a.29.5.0: automated matches [230678] (1 protein)
    not a true family
  6. 1995203Protein automated matches [230679] (2 species)
    not a true protein
  7. 1995204Species Human (Homo sapiens) [TaxId:9606] [230680] (8 PDB entries)
  8. 1995205Domain d2e0aa1: 2e0a A:20-187 [230683]
    Other proteins in same PDB: d2e0aa2, d2e0ab2
    automated match to d1jm6a1
    complexed with anp, mg

Details for d2e0aa1

PDB Entry: 2e0a (more details), 1.86 Å

PDB Description: Crystal structure of human pyruvate dehydrogenase kinase 4 in complex with AMPPNP
PDB Compounds: (A:) Pyruvate dehydrogenase kinase isozyme 4

SCOPe Domain Sequences for d2e0aa1:

Sequence, based on SEQRES records: (download)

>d2e0aa1 a.29.5.0 (A:20-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vprevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptql
vntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgii
eykdactvdpvtnqnlqyfldrfymnristrmlmnqhilifsdsqtgn

Sequence, based on observed residues (ATOM records): (download)

>d2e0aa1 a.29.5.0 (A:20-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vprevehfsryspsplsmkqlldfgscertsfaflrqelpvrlanilkeidilptqlvnt
ssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgiieyk
dactvdpvtnqnlqyfldrfymnristrmlmnqhilifsdsqtgn

SCOPe Domain Coordinates for d2e0aa1:

Click to download the PDB-style file with coordinates for d2e0aa1.
(The format of our PDB-style files is described here.)

Timeline for d2e0aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e0aa2