SCOPe 2.03: Domain d2e0aa1: 2e0a A:20-187

Lineage for d2e0aa1 (2e0a A:20-187)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.0: automated matches [230678] (1 protein)
   not a true family

6. Protein automated matches [230679] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [230680] (1 PDB entry)

8. Domain d2e0aa1: 2e0a A:20-187 [230683]
   Other proteins in same PDB: d2e0aa2, d2e0ab2
   automated match to d1jm6a1
   complexed with anp, mg

Details for d2e0aa1

PDB Entry: 2e0a, 1.86 Å

PDB Description: Crystal structure of human pyruvate dehydrogenase kinase 4 in complex with AMPPNP

PDB Compounds: (A:) Pyruvate dehydrogenase kinase isozyme 4

SCOPe Domain Sequences for d2e0aa1:

Sequence, based on SEQRES records:

>d2e0aa1 a.29.5.0 (A:20-187) automated matches {Homo sapiens [TaxId: 9606]}
vprevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptql
vntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgii
eykdactvdpvtnqnlqyfldrfymnristrmlmnqhilifsdsqtgn

Sequence, based on observed residues (ATOM records):

>d2e0aa1 a.29.5.0 (A:20-187) automated matches {Homo sapiens [TaxId: 9606]}
vprevehfsryspsplsmkqlldfgscertsfaflrqelpvrlanilkeidilptqlvnt
ssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgiieyk
dactvdpvtnqnlqyfldrfymnristrmlmnqhilifsdsqtgn

Timeline for d2e0aa1:

• d2e0aa1 is new in SCOPe 2.03-stable
  
• d2e0aa1 appears in SCOPe 2.04
  
• d2e0aa1 appears in the current release, SCOPe 2.08