SCOPe 2.06: Domain d2dxub1: 2dxu B:1-188

Lineage for d2dxub1 (2dxu B:1-188)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)

6. Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries)
   Uniprot O57883 1-188

8. Domain d2dxub1: 2dxu B:1-188 [230676]
   Other proteins in same PDB: d2dxua2, d2dxub2
   automated match to d1wnla2
   complexed with bt5; mutant

Details for d2dxub1

PDB Entry: 2dxu, 1.28 Å

PDB Description: crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation r48a

PDB Compounds: (B:) biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d2dxub1:

Sequence; same for both SEQRES and ATOM records:

>d2dxub1 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

Timeline for d2dxub1:

• d2dxub1 first appeared in SCOPe 2.03
  
• d2dxub1 appears in SCOPe 2.05
  
• d2dxub1 appears in SCOPe 2.07
  
• d2dxub1 appears in the current release, SCOPe 2.08