![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Achromobacter cycloclastes [TaxId:223] [49552] (15 PDB entries) |
![]() | Domain d1nibb1: 1nib B:8-166 [23066] complexed with cu |
PDB Entry: 1nib (more details), 2.7 Å
SCOPe Domain Sequences for d1nibb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nibb1 b.6.1.3 (B:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]} distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
Timeline for d1nibb1:
![]() Domains from other chains: (mouse over for more information) d1niba1, d1niba2, d1nibc1, d1nibc2 |