Lineage for d2doua_ (2dou A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898138Species Thermus thermophilus HB8 [TaxId:300852] [187350] (2 PDB entries)
  8. 2898140Domain d2doua_: 2dou A: [230652]
    automated match to d2x5da_
    complexed with epe, so4

Details for d2doua_

PDB Entry: 2dou (more details), 2.3 Å

PDB Description: probable N-succinyldiaminopimelate aminotransferase (TTHA0342) from Thermus thermophilus HB8
PDB Compounds: (A:) probable N-succinyldiaminopimelate aminotransferase

SCOPe Domain Sequences for d2doua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2doua_ c.67.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
vpepsvflvvdeakrkarergvglidlsigstdlpppeaplkalaealndpttygyclks
ctlpfleeaarwyegrygvgldprrealaligsqeglahlllaltepedllllpevayps
yfgaarvaslrtfliplredgladlkavpegvwreakvlllnypnnptgavadwgyfeea
lglarkhglwlihdnpyvdqvyegeapsplalpgakervvelfslsksynlagfrlgfal
gseealarlervkgvidfnqyagvlrmgvealktpkevvrgyarvyreralgmaealkgv
lsllppratmylwgrlpegvddlefglrlvergvalapgrgfgpggkgfvrialvrplee
lleaakrireal

SCOPe Domain Coordinates for d2doua_:

Click to download the PDB-style file with coordinates for d2doua_.
(The format of our PDB-style files is described here.)

Timeline for d2doua_: