SCOPe 2.04: Domain d1niba2: 1nib A:167-340

Lineage for d1niba2 (1nib A:167-340)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (15 PDB entries)

8. Domain d1niba2: 1nib A:167-340 [23065]
   complexed with cu

Details for d1niba2

PDB Entry: 1nib, 2.7 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1niba2:

Sequence; same for both SEQRES and ATOM records:

>d1niba2 b.6.1.3 (A:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

Timeline for d1niba2:

• d1niba2 first appeared (with stable ids) in SCOP 1.55
  
• d1niba2 appears in SCOPe 2.03
  
• d1niba2 appears in SCOPe 2.05
  
• d1niba2 appears in the current release, SCOPe 2.08