Lineage for d2deqb1 (2deq B:1-188)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967898Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. 2967907Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 2967908Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries)
    Uniprot O57883 1-188
  8. 2967946Domain d2deqb1: 2deq B:1-188 [230649]
    Other proteins in same PDB: d2deqa2, d2deqb2
    automated match to d1wnla2
    complexed with bt5; mutant

Details for d2deqb1

PDB Entry: 2deq (more details), 1.85 Å

PDB Description: crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation
PDB Compounds: (B:) 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d2deqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2deqb1 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykgiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOPe Domain Coordinates for d2deqb1:

Click to download the PDB-style file with coordinates for d2deqb1.
(The format of our PDB-style files is described here.)

Timeline for d2deqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2deqb2