Lineage for d2dd9b_ (2dd9 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643884Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1643885Protein automated matches [190526] (18 species)
    not a true protein
  7. 1643932Species Chiridius poppei [TaxId:286301] [230641] (2 PDB entries)
  8. 1643936Domain d2dd9b_: 2dd9 B: [230645]
    automated match to d2g3oa_
    complexed with cl, cxs; mutant

Details for d2dd9b_

PDB Entry: 2dd9 (more details), 2.3 Å

PDB Description: a mutant of gfp-like protein from chiridius poppei
PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d2dd9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dd9b_ d.22.1.0 (B:) automated matches {Chiridius poppei [TaxId: 286301]}
ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf
asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps
qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes
fsksgpmfthrrveethtkenlamveyqqvfnsaprd

SCOPe Domain Coordinates for d2dd9b_:

Click to download the PDB-style file with coordinates for d2dd9b_.
(The format of our PDB-style files is described here.)

Timeline for d2dd9b_: