![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (17 species) not a true protein |
![]() | Domain d2dd9a_: 2dd9 A: [230644] automated match to d2g3oa_ complexed with cl, cxs; mutant |
PDB Entry: 2dd9 (more details), 2.3 Å
SCOPe Domain Sequences for d2dd9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dd9a_ d.22.1.0 (A:) automated matches {Chiridius poppei [TaxId: 286301]} ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes fsksgpmfthrrveethtkenlamveyqqvfnsaprd
Timeline for d2dd9a_: