Lineage for d2d5vb2 (2d5v B:100-155)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692867Species Norway rat (Rattus norvegicus) [TaxId:10116] [230637] (1 PDB entry)
  8. 2692869Domain d2d5vb2: 2d5v B:100-155 [230640]
    Other proteins in same PDB: d2d5va1, d2d5vb1
    automated match to d1s7ea1
    protein/DNA complex; complexed with act, gol

Details for d2d5vb2

PDB Entry: 2d5v (more details), 2 Å

PDB Description: Crystal structure of HNF-6alpha DNA-binding domain in complex with the TTR promoter
PDB Compounds: (B:) Hepatocyte nuclear factor 6

SCOPe Domain Sequences for d2d5vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5vb2 a.4.1.0 (B:100-155) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
prlvftdvqrrtlhaifkenkrpskelqitisqqlglelstvsnffmnarrrsldk

SCOPe Domain Coordinates for d2d5vb2:

Click to download the PDB-style file with coordinates for d2d5vb2.
(The format of our PDB-style files is described here.)

Timeline for d2d5vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d5vb1