SCOPe 2.08: Domain d2d5vb2: 2d5v B:100-155

Lineage for d2d5vb2 (2d5v B:100-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [230637] (1 PDB entry)

8. Domain d2d5vb2: 2d5v B:100-155 [230640]
   Other proteins in same PDB: d2d5va1, d2d5vb1
   automated match to d1s7ea1
   protein/DNA complex; complexed with act, gol

Details for d2d5vb2

PDB Entry: 2d5v, 2 Å

PDB Description: Crystal structure of HNF-6alpha DNA-binding domain in complex with the TTR promoter

PDB Compounds: (B:) Hepatocyte nuclear factor 6

SCOPe Domain Sequences for d2d5vb2:

Sequence; same for both SEQRES and ATOM records:

>d2d5vb2 a.4.1.0 (B:100-155) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
prlvftdvqrrtlhaifkenkrpskelqitisqqlglelstvsnffmnarrrsldk

Timeline for d2d5vb2:

• d2d5vb2 first appeared in SCOPe 2.03
  
• d2d5vb2 appears in SCOPe 2.07