Class b: All beta proteins [48724] (165 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries) |
Domain d1niba1: 1nib A:8-166 [23064] |
PDB Entry: 1nib (more details), 2.7 Å
SCOP Domain Sequences for d1niba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1niba1 b.6.1.3 (A:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]} distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
Timeline for d1niba1:
View in 3D Domains from other chains: (mouse over for more information) d1nibb1, d1nibb2, d1nibc1, d1nibc2 |