Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [230637] (1 PDB entry) |
Domain d2d5va2: 2d5v A:100-155 [230638] Other proteins in same PDB: d2d5va1, d2d5vb1 automated match to d1s7ea1 protein/DNA complex; complexed with act, gol |
PDB Entry: 2d5v (more details), 2 Å
SCOPe Domain Sequences for d2d5va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d5va2 a.4.1.0 (A:100-155) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} prlvftdvqrrtlhaifkenkrpskelqitisqqlglelstvsnffmnarrrsldk
Timeline for d2d5va2: