Lineage for d2d3wa_ (2d3w A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366202Species Escherichia coli [TaxId:562] [226067] (2 PDB entries)
  8. 1366205Domain d2d3wa_: 2d3w A: [230632]
    automated match to d2d2ea_

Details for d2d3wa_

PDB Entry: 2d3w (more details), 2.5 Å

PDB Description: Crystal Structure of Escherichia coli SufC, an ATPase compenent of the SUF iron-sulfur cluster assembly machinery
PDB Compounds: (A:) Probable ATP-dependent transporter sufC

SCOPe Domain Sequences for d2d3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3wa_ c.37.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
ygwl

SCOPe Domain Coordinates for d2d3wa_:

Click to download the PDB-style file with coordinates for d2d3wa_.
(The format of our PDB-style files is described here.)

Timeline for d2d3wa_: