Lineage for d2d3wb_ (2d3w B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114119Species Escherichia coli [TaxId:562] [226067] (4 PDB entries)
  8. 2114127Domain d2d3wb_: 2d3w B: [230631]
    automated match to d2d2ea_

Details for d2d3wb_

PDB Entry: 2d3w (more details), 2.5 Å

PDB Description: Crystal Structure of Escherichia coli SufC, an ATPase compenent of the SUF iron-sulfur cluster assembly machinery
PDB Compounds: (B:) Probable ATP-dependent transporter sufC

SCOPe Domain Sequences for d2d3wb_:

Sequence, based on SEQRES records: (download)

>d2d3wb_ c.37.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
ygwlte

Sequence, based on observed residues (ATOM records): (download)

>d2d3wb_ c.37.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsldidal
kvvadgvnslrdgkrsfiivthyrildyikpdyvhvlyqgrivksgdftlvkqleeqgyg
wlte

SCOPe Domain Coordinates for d2d3wb_:

Click to download the PDB-style file with coordinates for d2d3wb_.
(The format of our PDB-style files is described here.)

Timeline for d2d3wb_: