Lineage for d1niac2 (1nia C:167-340)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381276Species Achromobacter cycloclastes [TaxId:223] [49552] (60 PDB entries)
  8. 2381385Domain d1niac2: 1nia C:167-340 [23063]
    complexed with cu

Details for d1niac2

PDB Entry: 1nia (more details), 2.5 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
PDB Compounds: (C:) nitrite reductase

SCOPe Domain Sequences for d1niac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1niac2 b.6.1.3 (C:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOPe Domain Coordinates for d1niac2:

Click to download the PDB-style file with coordinates for d1niac2.
(The format of our PDB-style files is described here.)

Timeline for d1niac2: