SCOP 1.59: Domain d1niac2: 1nia C:167-340

Lineage for d1niac2 (1nia C:167-340)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)

6. Protein Nitrite reductase, NIR [49551] (4 species)

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (7 PDB entries)

8. Domain d1niac2: 1nia C:167-340 [23063]

Details for d1niac2

PDB Entry: 1nia, 2.5 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted

SCOP Domain Sequences for d1niac2:

Sequence; same for both SEQRES and ATOM records:

>d1niac2 b.6.1.3 (C:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

Timeline for d1niac2:

• d1niac2 first appeared (with stable ids) in SCOP 1.55
  
• d1niac2 appears in SCOP 1.57
  
• d1niac2 appears in SCOP 1.61
  
• d1niac2 appears in the current release, SCOPe 2.08