Lineage for d1niac2 (1nia C:167-340)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11162Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 11202Protein Nitrite reductase, NIR [49551] (3 species)
  7. 11203Species Achromobacter cycloclastes [TaxId:223] [49552] (7 PDB entries)
  8. 11219Domain d1niac2: 1nia C:167-340 [23063]

Details for d1niac2

PDB Entry: 1nia (more details), 2.5 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted

SCOP Domain Sequences for d1niac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1niac2 b.6.1.3 (C:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOP Domain Coordinates for d1niac2:

Click to download the PDB-style file with coordinates for d1niac2.
(The format of our PDB-style files is described here.)

Timeline for d1niac2: