Lineage for d2csxb2 (2csx B:347-497)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993200Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1993201Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1993254Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1993255Protein automated matches [226872] (8 species)
    not a true protein
  7. 1993256Species Aquifex aeolicus [TaxId:63363] [230623] (2 PDB entries)
  8. 1993260Domain d2csxb2: 2csx B:347-497 [230626]
    Other proteins in same PDB: d2csxa1, d2csxb1
    automated match to d2d5ba1
    protein/RNA complex

Details for d2csxb2

PDB Entry: 2csx (more details), 2.7 Å

PDB Description: Crystal structure of Aquifex aeolicus methionyl-tRNA synthetase complexed with tRNA(Met)
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2csxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csxb2 a.27.1.0 (B:347-497) automated matches {Aquifex aeolicus [TaxId: 63363]}
laneignlysrvvnmahkflggevsgardeeyakiaqesiknyenymekvnfykaieeil
kftsylnkyvdekqpwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqml
gekeflkelkpyskntyklgerkilfpkreg

SCOPe Domain Coordinates for d2csxb2:

Click to download the PDB-style file with coordinates for d2csxb2.
(The format of our PDB-style files is described here.)

Timeline for d2csxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2csxb1