Class a: All alpha proteins [46456] (289 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (8 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [230623] (2 PDB entries) |
Domain d2csxb2: 2csx B:347-497 [230626] Other proteins in same PDB: d2csxa1, d2csxb1 automated match to d2d5ba1 protein/RNA complex |
PDB Entry: 2csx (more details), 2.7 Å
SCOPe Domain Sequences for d2csxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2csxb2 a.27.1.0 (B:347-497) automated matches {Aquifex aeolicus [TaxId: 63363]} laneignlysrvvnmahkflggevsgardeeyakiaqesiknyenymekvnfykaieeil kftsylnkyvdekqpwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqml gekeflkelkpyskntyklgerkilfpkreg
Timeline for d2csxb2: