SCOPe 2.05: Domain d2csxa2: 2csx A:347-497

Lineage for d2csxa2 (2csx A:347-497)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (8 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [230623] (2 PDB entries)

8. Domain d2csxa2: 2csx A:347-497 [230625]
   Other proteins in same PDB: d2csxa1, d2csxb1
   automated match to d2d5ba1
   protein/RNA complex

Details for d2csxa2

PDB Entry: 2csx, 2.7 Å

PDB Description: Crystal structure of Aquifex aeolicus methionyl-tRNA synthetase complexed with tRNA(Met)

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2csxa2:

Sequence; same for both SEQRES and ATOM records:

>d2csxa2 a.27.1.0 (A:347-497) automated matches {Aquifex aeolicus [TaxId: 63363]}
laneignlysrvvnmahkflggevsgardeeyakiaqesiknyenymekvnfykaieeil
kftsylnkyvdekqpwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqml
gekeflkelkpyskntyklgerkilfpkreg

Timeline for d2csxa2:

• d2csxa2 first appeared in SCOPe 2.03
  
• d2csxa2 appears in SCOPe 2.04
  
• d2csxa2 appears in SCOPe 2.06
  
• d2csxa2 appears in the current release, SCOPe 2.08