Lineage for d2csxb1 (2csx B:1-346)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106032Species Aquifex aeolicus [TaxId:63363] [230619] (2 PDB entries)
  8. 2106036Domain d2csxb1: 2csx B:1-346 [230622]
    Other proteins in same PDB: d2csxa2, d2csxb2
    automated match to d1a8ha2
    protein/RNA complex

Details for d2csxb1

PDB Entry: 2csx (more details), 2.7 Å

PDB Description: Crystal structure of Aquifex aeolicus methionyl-tRNA synthetase complexed with tRNA(Met)
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2csxb1:

Sequence, based on SEQRES records: (download)

>d2csxb1 c.26.1.0 (B:1-346) automated matches {Aquifex aeolicus [TaxId: 63363]}
mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
lgeyegwycvgceefkseaelaedhtcpihqkkceyikepsyffrlskyqdkllelyekn
pefiqpdyrrneiisfvkqglkdlsvtrprsrvkwgipvpfdpehtiyvwfdalfnyisa
ledkveiywpadlhlvgkdilrfhtvywpaflmslgyelpkkvfahgwwtvegkkmsktl
gnvvdpyevvqeygldevryfllrevpfgqdgdfskkailnringe

Sequence, based on observed residues (ATOM records): (download)

>d2csxb1 c.26.1.0 (B:1-346) automated matches {Aquifex aeolicus [TaxId: 63363]}
mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
lgeykepsyffrlskyqdkllelyeknpefiqpdyrrneiisfvkqglkdlsvtrprsrv
kwgipvpfdpehtiyvwfdalfnyisaledkveiywpadlhlvgkdilrfhtvywpaflm
slgyelpkkvfahgwwtvegkkmsktlgnvvdpyevvqeygldevryfllrevpfgqdgd
fskkailnringe

SCOPe Domain Coordinates for d2csxb1:

Click to download the PDB-style file with coordinates for d2csxb1.
(The format of our PDB-style files is described here.)

Timeline for d2csxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2csxb2