SCOPe 2.08: Domain d1niac1: 1nia C:8-166

Lineage for d1niac1 (1nia C:8-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)

7. Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries)

8. Domain d1niac1: 1nia C:8-166 [23062]
   Other proteins in same PDB: d1niaa2, d1niab2, d1niac2
   complexed with cu

Details for d1niac1

PDB Entry: 1nia, 2.5 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted

PDB Compounds: (C:) nitrite reductase

SCOPe Domain Sequences for d1niac1:

Sequence; same for both SEQRES and ATOM records:

>d1niac1 b.6.1.3 (C:8-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d1niac1:

• d1niac1 first appeared (with stable ids) in SCOP 1.55
  
• d1niac1 appears in SCOPe 2.07