SCOPe 2.03: Domain d2cfob2: 2cfo B:312-488

Lineage for d2cfob2 (2cfo B:312-488)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families)

5. Family a.97.1.0: automated matches [227179] (1 protein)
   not a true family

6. Protein automated matches [226898] (4 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:32046] [225114] (1 PDB entry)

8. Domain d2cfob2: 2cfo B:312-488 [230618]
   Other proteins in same PDB: d2cfoa1, d2cfob1
   automated match to d2cfoa2

Details for d2cfob2

PDB Entry: 2cfo, 2.45 Å

PDB Description: non-discriminating glutamyl-trna synthetase from thermosynechococcus elongatus in complex with glu

PDB Compounds: (B:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cfob2:

Sequence; same for both SEQRES and ATOM records:

>d2cfob2 a.97.1.0 (B:312-488) automated matches {Synechococcus elongatus [TaxId: 32046]}
dwdklnwlnrqyiqqlepeeflaeliplwqgagyafdeerdrpwlfdlaqllqpglntlr
eaidqgavffipsvtfdseamaqlgqpqsatilayllehlpaepaltvamgqqliqqaak
aagvkkgatmrtlraaltgavhgpdlmaawqilhqrgwdeprlaaalkqaqttsleh

Timeline for d2cfob2:

• d2cfob2 is new in SCOPe 2.03-stable
  
• d2cfob2 appears in SCOPe 2.04
  
• d2cfob2 appears in the current release, SCOPe 2.08