SCOPe 2.05: Domain d2ca9b2: 2ca9 B:61-147

Lineage for d2ca9b2 (2ca9 B:61-147)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.0: automated matches [227175] (1 protein)
   not a true family

6. Protein automated matches [226892] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)

8. Domain d2ca9b2: 2ca9 B:61-147 [230615]
   Other proteins in same PDB: d2ca9a1, d2ca9b1
   automated match to d2bj9a2
   complexed with fmt, gol

Details for d2ca9b2

PDB Entry: 2ca9, 2.05 Å

PDB Description: apo-NIKR from helicobacter pylori in closed trans-conformation

PDB Compounds: (B:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2ca9b2:

Sequence; same for both SEQRES and ATOM records:

>d2ca9b2 d.58.18.0 (B:61-147) automated matches {Helicobacter pylori [TaxId: 85962]}
deskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei
qrlqleigglrgvkfakltkassfeyn

Timeline for d2ca9b2:

• d2ca9b2 first appeared in SCOPe 2.03
  
• d2ca9b2 appears in SCOPe 2.04
  
• d2ca9b2 appears in SCOPe 2.06
  
• d2ca9b2 appears in the current release, SCOPe 2.08