Lineage for d2caja2 (2caj A:61-141)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176307Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2176520Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 2176521Protein automated matches [226892] (5 species)
    not a true protein
  7. 2176545Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)
  8. 2176558Domain d2caja2: 2caj A:61-141 [230613]
    Other proteins in same PDB: d2caja1, d2cajb1
    automated match to d2bj9a2
    complexed with cl, gol, ni

Details for d2caja2

PDB Entry: 2caj (more details), 2.35 Å

PDB Description: nikr from helicobacter pylori in closed trans-conformation and nickel bound to 4 intermediary sites
PDB Compounds: (A:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2caja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2caja2 d.58.18.0 (A:61-141) automated matches {Helicobacter pylori [TaxId: 85962]}
deskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei
qrlqleigglrgvkfakltka

SCOPe Domain Coordinates for d2caja2:

Click to download the PDB-style file with coordinates for d2caja2.
(The format of our PDB-style files is described here.)

Timeline for d2caja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2caja1