SCOPe 2.08: Domain d2cadb2: 2cad B:62-147

Lineage for d2cadb2 (2cad B:62-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.0: automated matches [227175] (1 protein)
   not a true family

6. Protein automated matches [226892] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)

8. Domain d2cadb2: 2cad B:62-147 [230612]
   Other proteins in same PDB: d2cada1, d2cadb1
   automated match to d2bj9a2
   complexed with cit, fmt, gol, ni

Details for d2cadb2

PDB Entry: 2cad, 2.3 Å

PDB Description: nikr from helicobacter pylori in closed trans-conformation and nickel bound to 2f, 2x and 2i sites.

PDB Compounds: (B:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2cadb2:

Sequence; same for both SEQRES and ATOM records:

>d2cadb2 d.58.18.0 (B:62-147) automated matches {Helicobacter pylori [TaxId: 85962]}
eskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfeiq
rlqleigglrgvkfakltkassfeyn

Timeline for d2cadb2:

• d2cadb2 first appeared in SCOPe 2.03
  
• d2cadb2 appears in SCOPe 2.07