Lineage for d1niab2 (1nia B:167-340)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1775028Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 1775029Species Achromobacter cycloclastes [TaxId:223] [49552] (15 PDB entries)
  8. 1775067Domain d1niab2: 1nia B:167-340 [23061]
    complexed with cu

Details for d1niab2

PDB Entry: 1nia (more details), 2.5 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d1niab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1niab2 b.6.1.3 (B:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOPe Domain Coordinates for d1niab2:

Click to download the PDB-style file with coordinates for d1niab2.
(The format of our PDB-style files is described here.)

Timeline for d1niab2: