![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries) |
![]() | Domain d1niab2: 1nia B:167-340 [23061] |
PDB Entry: 1nia (more details), 2.5 Å
SCOP Domain Sequences for d1niab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1niab2 b.6.1.3 (B:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]} gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
Timeline for d1niab2:
![]() Domains from other chains: (mouse over for more information) d1niaa1, d1niaa2, d1niac1, d1niac2 |