SCOPe 2.08: Domain d2cfob1: 2cfo B:2-311

Lineage for d2cfob1 (2cfo B:2-311)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:32046] [225113] (1 PDB entry)

8. Domain d2cfob1: 2cfo B:2-311 [230601]
   Other proteins in same PDB: d2cfoa2, d2cfob2, d2cfob3
   automated match to d2cfoa1
   protein/RNA complex; complexed with glu

Details for d2cfob1

PDB Entry: 2cfo, 2.45 Å

PDB Description: non-discriminating glutamyl-trna synthetase from thermosynechococcus elongatus in complex with glu

PDB Compounds: (B:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cfob1:

Sequence; same for both SEQRES and ATOM records:

>d2cfob1 c.26.1.0 (B:2-311) automated matches {Synechococcus elongatus [TaxId: 32046]}
tvrvrlapsptgnlhigtartavfnwlyarhrggkfilriedtdrersrpeytenilegl
qwlgltwdegpyfqsdrldlyrqaiqtlldkglayycyctpeelealraeqkakgqapry
dnrhrhltpeeqaafeaagrtpvirfkieddrqiewqdlvrgrvswqgadlggdmviara
aprgeigyplynlvvvvddiamgitdvirgedhigntpkqillyealgatppnfahtpli
lnstgqklskrdgvtsisdframgylapalanymtllgwsppegvgelftldlaakhfsf
erinkagarf

Timeline for d2cfob1:

• d2cfob1 first appeared in SCOPe 2.03
  
• d2cfob1 appears in SCOPe 2.07