Lineage for d2cfob1 (2cfo B:2-311)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861151Species Synechococcus elongatus [TaxId:32046] [225113] (1 PDB entry)
  8. 2861153Domain d2cfob1: 2cfo B:2-311 [230601]
    Other proteins in same PDB: d2cfoa2, d2cfob2, d2cfob3
    automated match to d2cfoa1
    protein/RNA complex; complexed with glu

Details for d2cfob1

PDB Entry: 2cfo (more details), 2.45 Å

PDB Description: non-discriminating glutamyl-trna synthetase from thermosynechococcus elongatus in complex with glu
PDB Compounds: (B:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cfob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfob1 c.26.1.0 (B:2-311) automated matches {Synechococcus elongatus [TaxId: 32046]}
tvrvrlapsptgnlhigtartavfnwlyarhrggkfilriedtdrersrpeytenilegl
qwlgltwdegpyfqsdrldlyrqaiqtlldkglayycyctpeelealraeqkakgqapry
dnrhrhltpeeqaafeaagrtpvirfkieddrqiewqdlvrgrvswqgadlggdmviara
aprgeigyplynlvvvvddiamgitdvirgedhigntpkqillyealgatppnfahtpli
lnstgqklskrdgvtsisdframgylapalanymtllgwsppegvgelftldlaakhfsf
erinkagarf

SCOPe Domain Coordinates for d2cfob1:

Click to download the PDB-style file with coordinates for d2cfob1.
(The format of our PDB-style files is described here.)

Timeline for d2cfob1: