Class a: All alpha proteins [46456] (289 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.0: automated matches [230594] (1 protein) not a true family |
Protein automated matches [230595] (4 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries) |
Domain d2caja1: 2caj A:9-60 [230599] Other proteins in same PDB: d2caja2, d2cajb2 automated match to d2bj9a1 complexed with cl, gol, ni |
PDB Entry: 2caj (more details), 2.35 Å
SCOPe Domain Sequences for d2caja1:
Sequence, based on SEQRES records: (download)
>d2caja1 a.43.1.0 (A:9-60) automated matches {Helicobacter pylori [TaxId: 85962]} siirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednpn
>d2caja1 a.43.1.0 (A:9-60) automated matches {Helicobacter pylori [TaxId: 85962]} siirfsvslqqnlldeldnriikngyssrselvrdmireklvednpn
Timeline for d2caja1: