SCOPe 2.08: Domain d2caja1: 2caj A:9-60

Lineage for d2caja1 (2caj A:9-60)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.0: automated matches [230594] (1 protein)
   not a true family

6. Protein automated matches [230595] (4 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries)

8. Domain d2caja1: 2caj A:9-60 [230599]
   Other proteins in same PDB: d2caja2, d2cajb2
   automated match to d2bj9a1
   complexed with cl, gol, ni

Details for d2caja1

PDB Entry: 2caj, 2.35 Å

PDB Description: nikr from helicobacter pylori in closed trans-conformation and nickel bound to 4 intermediary sites

PDB Compounds: (A:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2caja1:

Sequence, based on SEQRES records:

>d2caja1 a.43.1.0 (A:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}
siirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednpn

Sequence, based on observed residues (ATOM records):

>d2caja1 a.43.1.0 (A:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}
siirfsvslqqnlldeldnriikngyssrselvrdmireklvednpn

Timeline for d2caja1:

• d2caja1 first appeared in SCOPe 2.03
  
• d2caja1 appears in SCOPe 2.07