Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Achromobacter cycloclastes [TaxId:223] [49552] (60 PDB entries) |
Domain d1niaa2: 1nia A:167-340 [23059] complexed with cu |
PDB Entry: 1nia (more details), 2.5 Å
SCOPe Domain Sequences for d1niaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1niaa2 b.6.1.3 (A:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]} gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
Timeline for d1niaa2:
View in 3D Domains from other chains: (mouse over for more information) d1niab1, d1niab2, d1niac1, d1niac2 |